PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004954m
Common NameEUTSA_v10004954mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 23127 Da    PI: 10.3699
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004954mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.7e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien + rqvtfskRrng+lKKA+ELSvLCda+v++iifs++g+lye+s+
  Thhalv10004954m  9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQVSLIIFSQKGRLYEFSN 59
                     68***********************************************95 PP

2K-box69.98.1e-2477171498
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       +++s +e   ++l+qe++ +  +ie L+  +R+llG+++ s+sl+eLq++ +qL +sl k+R++K +l++eq+e+lq kek+l een +Lr+k
  Thhalv10004954m  77 ETSNSDSEIYIQQLKQEASHMITKIELLEFHKRKLLGQGIASCSLEELQEIDSQLRRSLGKVRARKAQLFKEQLEKLQAKEKQLLEENVQLRQK 170
                      44555788889******************999*************************************************************9 PP

            K-box  98 l 98 
                      +
  Thhalv10004954m 171 V 171
                      7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.043161IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-31323IPR002100Transcription factor, MADS-box
CDDcd002659.25E-42378No hitNo description
SuperFamilySSF554551.31E-32380IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.38187177IPR002487Transcription factor, K-box
PfamPF014862.2E-2387171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQVSLIIFSQ KGRLYEFSNS  60
DMQTTIERYR KHTKDHETSN SDSEIYIQQL KQEASHMITK IELLEFHKRK LLGQGIASCS  120
LEELQEIDSQ LRRSLGKVRA RKAQLFKEQL EKLQAKEKQL LEENVQLRQK VIHLSFQFTY  180
LIRHMLILIQ LKLHIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-21182183Myocyte-specific enhancer factor 2B
1tqe_R2e-21182183Myocyte-specific enhancer factor 2B
1tqe_Q2e-21182183Myocyte-specific enhancer factor 2B
1tqe_P2e-21182183Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0542200.0AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0652060.0AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY0660350.0AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0965090.0AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY1412130.0AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394426.11e-138hypothetical protein EUTSA_v10004954mg
SwissprotQ9FIS11e-109AGL42_ARATH; MADS-box protein AGL42
TrEMBLV4KP351e-138V4KP35_EUTSA; Uncharacterized protein
STRINGAT5G62165.11e-107(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.31e-92AGAMOUS-like 42